PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10012605m
Common NameCARUB_v10012605mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 251aa    MW: 29077.6 Da    PI: 8.932
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10012605mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.4e-18550147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+++W++Ia+++  gR++k+c++rw++ 
  Carubv10012605m  5 RGHWRPAEDEKLRELVEQFGPHNWNAIAQKLS-GRSGKSCRLRWFNQ 50
                     899*****************************.***********996 PP

2Myb_DNA-binding55.51.3e-1757100146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Carubv10012605m  57 RNPFTEEEEERLLASHRIHGNR-WSVIARFFP-GRTDNAVKNHWHV 100
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.039155IPR017930Myb domain
SMARTSM007179.3E-15453IPR001005SANT/Myb domain
PfamPF002497.7E-17550IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-30598IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-27658IPR009057Homeodomain-like
CDDcd001671.72E-13849No hitNo description
PROSITE profilePS5129418.71356106IPR017930Myb domain
SMARTSM007171.3E-1556104IPR001005SANT/Myb domain
PfamPF002491.8E-145799IPR001005SANT/Myb domain
CDDcd001674.12E-125999No hitNo description
Gene3DG3DSA:1.10.10.607.0E-2159104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MMCSRGHWRP AEDEKLRELV EQFGPHNWNA IAQKLSGRSG KSCRLRWFNQ LDPRINRNPF  60
TEEEEERLLA SHRIHGNRWS VIARFFPGRT DNAVKNHWHV IMARRGRERS KLRPRGLGHD  120
ATAAATGMIM GNYNDYDKET RLATTTALNF PYQFSHINHF QVLKEFLTGK IGFPNSTTPI  180
KEDAIDQTKR PVEFYNFLQV NTDSKKPEVI DNSRKDEDED FHENNRIRNE NCVPFFDFLS  240
VGNSASQGLC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3151057107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195540.0AY519554.1 Arabidopsis thaliana MYB transcription factor (At1g17950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303242.10.0hypothetical protein CARUB_v10012605mg
TrEMBLR0ID700.0R0ID70_9BRAS; Uncharacterized protein
STRINGAT1G17950.11e-171(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-175myb domain protein 52